Now Offering Over 102,157 Antibodies & 44,722 Antigens!

OVOL2 antibody - N-terminal region (ARP39499_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP39499_P050-FITC Conjugated

ARP39499_P050-HRP Conjugated

ARP39499_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ovo-like 2 (Drosophila)
Protein Name:
Transcription factor Ovo-like 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-127275 from Santa Cruz Biotechnology.
Description of Target:
OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OVOL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OVOL2.
The immunogen is a synthetic peptide directed towards the N terminal region of human OVOL2
Species Reactivity:
Cow, Dog, Horse, Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%
Complete computational species homology data:
Anti-OVOL2 (ARP39499_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-OVOL2 (ARP39499_P050) antibody is Catalog # AAP39499 (Previous Catalog # AAPP23064)
Printable datasheet for anti-OVOL2 (ARP39499_P050) antibody
Target Reference:
Li,B., (2002) Genomics 80 (3), 319-325

Tell us what you think about this item!

Write A Review
    Please, wait...