Now Offering Over 102,157 Antibodies & 44,722 Antigens!

OVOL2 antibody - middle region (ARP39500_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP39500_P050-FITC Conjugated

ARP39500_P050-HRP Conjugated

ARP39500_P050-Biotin Conjugated

Gene Symbol:
OVOL2
NCBI Gene Id:
58495
Official Gene Full Name:
Ovo-like 2 (Drosophila)
Protein Name:
Transcription factor Ovo-like 2
Swissprot Id:
Q9BRP0
Protein Accession #:
NP_067043
Nucleotide Accession #:
NM_021220
Alias Symbols:
EUROIMAGE566589, ZNF339
Replacement Item:
This antibody may replace item sc-127275 from Santa Cruz Biotechnology.
Description of Target:
OVOL2 contains 4 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family. It is a DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcription regulator.
Protein Size (# AA):
275
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IF
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OVOL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OVOL2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human OVOL2
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-OVOL2 (ARP39500_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3;
Blocking Peptide:
For anti-OVOL2 (ARP39500_P050) antibody is Catalog # AAP39500 (Previous Catalog # AAPP23065)
Datasheets/Manuals:
Printable datasheet for anti-OVOL2 (ARP39500_P050) antibody
Target Reference:
Li,B., (2002) Genomics 80 (3), 319-325

Tell us what you think about this item!

Write A Review
    Please, wait...