Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ORMDL3 antibody - N-terminal region (ARP64372_P050)

100 ul
In Stock

Conjugation Options

ARP64372_P050-FITC Conjugated

ARP64372_P050-HRP Conjugated

ARP64372_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
ORM1-like 3 (S. cerevisiae)
Protein Name:
ORM1-like protein 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-151316 from Santa Cruz Biotechnology.
Description of Target:
ORMDL3 is a negative regulator of sphingolipid synthesis. ORMDL3 may indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ORMDL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ORMDL3.
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ORMDL3 (ARP64372_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ORMDL3 (ARP64372_P050) antibody is Catalog # AAP64372
Printable datasheet for anti-ORMDL3 (ARP64372_P050) antibody
Pan specific ORMDL1-3 antibody. Predicted to react with ORMDL1, ORMDL2 and ORMDL3.

Tell us what you think about this item!

Write A Review
    Please, wait...