Now Offering Over 102,157 Antibodies & 44,722 Antigens!

OMP Recombinant Protein (Rickettsia japonica) (OPCA04446)

* Required Fields

$0.00
In Stock
Gene Symbol:
OMP
Swissprot Id:
Q52764
Protein Name:
17 kDa surface antigen
Molecular Weight:
31 kDa
Product Format:
Liquid
Species Reactivity:
Rickettsia japonica
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Rickettsia japonica (strain ATCC VR-1363 / YH)
Tag:
N-terminal 6xHis-SUMO-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR.Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995)
Datasheets/Manuals:
Printable datasheet for OPCA04446
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...