Now Offering Over 102,157 Antibodies & 44,722 Antigens!

OLIG2 antibody - N-terminal region (ARP32752_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32752_P050-FITC Conjugated

ARP32752_P050-HRP Conjugated

ARP32752_P050-Biotin Conjugated

Gene Symbol:
OLIG2
NCBI Gene Id:
10215
Official Gene Full Name:
Oligodendrocyte lineage transcription factor 2
Protein Name:
Oligodendrocyte transcription factor 2
Swissprot Id:
Q13516
Protein Accession #:
NP_005797
Nucleotide Accession #:
NM_005806
Alias Symbols:
BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Replacement Item:
This antibody may replace item sc-133869 from Santa Cruz Biotechnology.
Description of Target:
OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
323
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OLIG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OLIG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-OLIG2 (ARP32752_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;
Blocking Peptide:
For anti-OLIG2 (ARP32752_P050) antibody is Catalog # AAP32752 (Previous Catalog # AAPP03766)
Datasheets / Downloads:
Printable datasheet for anti-OLIG2 (ARP32752_P050) antibody
Target Reference:
Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)

Customer Reviews for OLIG2 Antibody (ARP32752_P050) tested with human optic nerve and spinal cord in Immunohistochemistry

CAT#ARP32752
-submitted by
Alison Jennings
UWA
School of Pathology and Laboratory Medicine M504

• Lyophilized antibody samples reconstituted in 10ul distilled water
• Antibody dilutions made up in PBS
• Microwave Antigen retrieval of sections carried out in 0.5% citraconic anhydride (Sigma) pH7.4 for 25 minutes at 92 C followed by cooling to ambient temperature (approx. 20 minutes)
• Blocking step 10% normal horse serum in PBS
• Primary antibody incubation for 2 hours at 37C then overnight at 4C
• Blocking of non specific peroxidase with 3% hydrogen peroxide for 5 minutes
• Secondary link antibody either PolyEnvision (pEV; Dako) or Novolink (NL; Novocastra)
• Chromogen DAB (Vector ImmPACT)

Tissue sections

A/ [IHC-PZ] (optimal processing)
human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns

A2/ [IHC-PZ + FF]
As above for initial fixation then post-fixed in 10% buffered formalin for 5 days

B/ [IHC-P]
human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns

Controls
Negative: omission of primary.
Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P)

Product Protocols: OLIG2 antibody tested with Human Hepg2 Cells (ARP32752_P050)

Aviva Systems Biology is the original manufacturer of this OLIG2 antibody (ARP32752_P050)

Click here to view the OLIG2 antibody Western Blot Protocol

Product Datasheet Link: OLIG2 antibody (ARP32752_P050)

WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s OLIG2 antibody (ARP32752_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...