Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NUP50 antibody - C-terminal region (ARP52288_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP52288_P050-FITC Conjugated

ARP52288_P050-HRP Conjugated

ARP52288_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Nucleoporin 50kDa
Protein Name:
Nuclear pore complex protein Nup50
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC39961, NPAP60, NPAP60L
Replacement Item:
This antibody may replace item sc-133859 from Santa Cruz Biotechnology.
Description of Target:
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUP50.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUP50.
The immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%; Yeast: 80%
Complete computational species homology data:
Anti-NUP50 (ARP52288_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NUP50 (ARP52288_P050) antibody is Catalog # AAP52288 (Previous Catalog # AAPS30802)
Printable datasheet for anti-NUP50 (ARP52288_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that NUP50 is expressed in HepG2

NUP50 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...