Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NUP35 antibody - N-terminal region (ARP52578_P050)

  • Catalog#: ARP52578_P050
  • Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

Discontinued

Conjugation Options

ARP52578_P050-FITC Conjugated

ARP52578_P050-HRP Conjugated

ARP52578_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NUP35
NCBI Gene Id:
129401
Official Gene Full Name:
Nucleoporin 35kDa
Protein Name:
Nucleoporin NUP53
Swissprot Id:
Q8NFH5
Protein Accession #:
NP_612142
Nucleotide Accession #:
NM_138285
Alias Symbols:
MP44, NP44, NUP53
Description of Target:
NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.
Protein Size (# AA):
326
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUP35.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUP35.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NUP35
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NUP35 (ARP52578_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KCTD9; FAM96B; CIAO1; MMS19; UBC; ILF3;
Blocking Peptide:
For anti-NUP35 (ARP52578_P050) antibody is Catalog # AAP52578 (Previous Catalog # AAPS32407)
Datasheets/Manuals:
Printable datasheet for anti-NUP35 (ARP52578_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Tell us what you think about this item!

Write A Review
    Please, wait...