Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NRF1 antibody - N-terminal region (ARP38542_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38542_P050-FITC Conjugated

ARP38542_P050-HRP Conjugated

ARP38542_P050-Biotin Conjugated

Gene Symbol:
NRF1
NCBI Gene Id:
4899
Official Gene Full Name:
Nuclear respiratory factor 1
Protein Name:
Nuclear respiratory factor 1
Swissprot Id:
Q16656
Protein Accession #:
NP_005002
Nucleotide Accession #:
NM_005011
Alias Symbols:
ALPHA-PAL
Replacement Item:
This antibody may replace item sc-101102 from Santa Cruz Biotechnology.
Description of Target:
NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for 'nuclear factor (erythroid-derived 2)-like 1' which has an official symbol of NFE2L1.
Protein Size (# AA):
503
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NRF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NRF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NRF1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-NRF1 (ARP38542_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
POGZ; TRAF2; SP4; FHL2; DYNLL1; CSNK2B; CSNK2A1; UBC; HHV8GK18_gp81; CEBPB; PARP1; PPRC1; MAFF; PPARGC1A; Dynlt1b; CDK1; MRPL57; TFAM;
Blocking Peptide:
For anti-NRF1 (ARP38542_P050) antibody is Catalog # AAP38542 (Previous Catalog # AAPP20733)
Datasheets/Manuals:
Printable datasheet for anti-NRF1 (ARP38542_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that NRF1 is expressed in HEK293T

Target Reference:
Ramachandran,B., (2008) J. Biol. Chem. 283 (18), 11935-11946

Tell us what you think about this item!

Write A Review
    Please, wait...