Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NONO antibody - C-terminal region (ARP40716_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40716_T100-FITC Conjugated

ARP40716_T100-HRP Conjugated

ARP40716_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Non-POU domain containing, octamer-binding
Protein Name:
Non-POU domain-containing octamer-binding protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
P54, NMT55, NRB54, P54NRB
Replacement Item:
This antibody may replace item sc-23247 from Santa Cruz Biotechnology.
Description of Target:
NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NONO.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NONO.
The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NONO (ARP40716_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NONO (ARP40716_T100) antibody is Catalog # AAP40716 (Previous Catalog # AAPP10454)
Printable datasheet for anti-NONO (ARP40716_T100) antibody
Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Tell us what you think about this item!

Write A Review
    Please, wait...