Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NKX2-2 antibody - N-terminal region (ARP32338_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32338_P050-FITC Conjugated

ARP32338_P050-HRP Conjugated

ARP32338_P050-Biotin Conjugated

Gene Symbol:
NKX2-2
NCBI Gene Id:
4821
Official Gene Full Name:
NK2 homeobox 2
Protein Name:
Homeobox protein Nkx-2.2
Swissprot Id:
O95096
Protein Accession #:
NP_002500
Nucleotide Accession #:
NM_002509
Alias Symbols:
NKX2.2, NKX2B
Replacement Item:
This antibody may replace item sc-133825, HPA003468
Description of Target:
Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.
Protein Size (# AA):
273
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NKX2-2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NKX2-2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-NKX2-2 (ARP32338_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Dlg4; SIN3A; HDAC1; OLIG2;
Blocking Peptide:
For anti-NKX2-2 (ARP32338_P050) antibody is Catalog # AAP32338 (Previous Catalog # AAPP03326)
Datasheets/Manuals:
Printable datasheet for anti-NKX2-2 (ARP32338_P050) antibody
Target Reference:
Owen,L.A., (er) PLoS ONE 3 (4), E1965 (2008)

Tell us what you think about this item!

Write A Review
    Please, wait...