Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NFIX antibody - middle region (ARP32717_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32717_P050-FITC Conjugated

ARP32717_P050-HRP Conjugated

ARP32717_P050-Biotin Conjugated

Gene Symbol:
NFIX
NCBI Gene Id:
4784
Official Gene Full Name:
Nuclear factor I/X (CCAAT-binding transcription factor)
Protein Name:
Nuclear factor 1 X-type
Swissprot Id:
Q14938-3
Protein Accession #:
NP_002492
Nucleotide Accession #:
NM_002501
Alias Symbols:
NF1A
Replacement Item:
This antibody may replace item sc-122030 from Santa Cruz Biotechnology.
Description of Target:
Nuclear factor I (NFI) proteins constitute a family of sequence-specific transcription factors whose functional diversity is generated through transcription from four different genes (NFI-A, NFI-B, NFI-C, and NFI-X), alternative RNA splicing, and protein heterodimerization. NFI-X has divergent functions after binding in promoter or enhancer position. This property, combined with the differential expression of NFI-X, can achieve cell-type specificity of NFI dependent promoters and enhancers.
Protein Size (# AA):
441
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFIX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFIX.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NFIX
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-NFIX (ARP32717_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
QRICH1; NFIX; ZNF614; SUMO1; UBC; NEDD8; JMJD6; ISG15; NFIB; PIR; RFX1; SKI; RB1; HDAC1;
Blocking Peptide:
For anti-NFIX (ARP32717_P050) antibody is Catalog # AAP32717 (Previous Catalog # AAPP03731)
Datasheets/Manuals:
Printable datasheet for anti-NFIX (ARP32717_P050) antibody
Target Reference:
Norquay,L.D., et al., (2003) Mol. Endocrinol. 17 (6), 1027-1038

Tell us what you think about this item!

Write A Review
    Please, wait...