Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NEUROG1 antibody - C-terminal region (ARP32038_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32038_P050-FITC Conjugated

ARP32038_P050-HRP Conjugated

ARP32038_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NEUROG1
NCBI Gene Id:
4762
Official Gene Full Name:
Neurogenin 1
Protein Name:
Neurogenin-1
Swissprot Id:
Q92886
Protein Accession #:
NP_006152
Nucleotide Accession #:
NM_006161
Alias Symbols:
AKA, Math4C, NEUROD3, ngn1, bHLHa6
Description of Target:
NEUROG1 contains 1 basic helix-loop-helix (bHLH) domain. It appears to mediate neuronal differentiation.
Protein Size (# AA):
237
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NEUROG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NEUROG1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NEUROG1
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 93%
Complete computational species homology data:
Anti-NEUROG1 (ARP32038_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TCF4; CBFA2T2; TARBP2; RUNX1T1; SMAD1; CREBBP; EP300;
Blocking Peptide:
For anti-NEUROG1 (ARP32038_P050) antibody is Catalog # AAP32038 (Previous Catalog # AAPP02940)
Datasheets/Manuals:
Printable datasheet for anti-NEUROG1 (ARP32038_P050) antibody
Target Reference:
Fanous,A.H., (2007) Am. J. Med. Genet. B Neuropsychiatr. Genet. 144 (2), 207-214

Tell us what you think about this item!

Write A Review
    Please, wait...