Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NETO1 antibody - C-terminal region (ARP59810_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59810_P050-FITC Conjugated

ARP59810_P050-HRP Conjugated

ARP59810_P050-Biotin Conjugated

Gene Symbol:
NETO1
NCBI Gene Id:
81832
Official Gene Full Name:
Neuropilin (NRP) and tolloid (TLL)-like 1
Protein Name:
Neuropilin and tolloid-like protein 1
Swissprot Id:
Q8R4I7
Protein Accession #:
NP_620416
Nucleotide Accession #:
NM_138966
Alias Symbols:
BCTL1, BTCL1
Replacement Item:
This antibody may replace item sc-75901 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
533
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NETO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NETO1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NETO1 (ARP59810_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3;
Blocking Peptide:
For anti-NETO1 (ARP59810_P050) antibody is Catalog # AAP59810 (Previous Catalog # AAPP45969)
Datasheets/Manuals:
Printable datasheet for anti-NETO1 (ARP59810_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...