Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NEK6 antibody - N-terminal region (ARP48756_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP48756_P050-FITC Conjugated

ARP48756_P050-HRP Conjugated

ARP48756_P050-Biotin Conjugated

Gene Symbol:
NEK6
NCBI Gene Id:
10783
Official Gene Full Name:
NIMA (never in mitosis gene a)-related kinase 6
Protein Name:
Serine/threonine-protein kinase Nek6
Swissprot Id:
Q9HC98
Protein Accession #:
NP_055212
Nucleotide Accession #:
NM_014397
Alias Symbols:
SID6-1512
Replacement Item:
This antibody may replace item sc-134833 from Santa Cruz Biotechnology.
Description of Target:
The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
313
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NEK6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NEK6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NEK6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Complete computational species homology data:
Anti-NEK6 (ARP48756_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
IKZF1; INCA1; CCDC36; KRT40; LNX1; LZTS2; FAM208B; NECAB2; HSD17B14; IKZF3; TNK2; TCF4; TRIM27; KRT31; TRIM23; XIAP; AES; PRDX3; NEK6; CIR1; TRIP4; RPS7; RELB; RBBP6; PTN; PHF1; CDC42; ATF4; ERCC6L2; ARHGAP33; NEK9; PRAM1; ANKRA2; PAK6; KCTD5; ARRB1; DERA
Blocking Peptide:
For anti-NEK6 (ARP48756_P050) antibody is Catalog # AAP48756 (Previous Catalog # AAPP28807)
Datasheets/Manuals:
Printable datasheet for anti-NEK6 (ARP48756_P050) antibody
Target Reference:
Lee,E.J., (2007) Biochem. Biophys. Res. Commun. 358 (3), 783-788

Tell us what you think about this item!

Write A Review
    Please, wait...