Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NAT2 antibody - middle region (ARP44195_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP44195_T100-FITC Conjugated

ARP44195_T100-HRP Conjugated

ARP44195_T100-Biotin Conjugated

Gene Symbol:
NAT2
NCBI Gene Id:
10
Official Gene Full Name:
N-acetyltransferase 2 (arylamine N-acetyltransferase)
Protein Name:
Arylamine N-acetyltransferase 2
Swissprot Id:
P11245
Protein Accession #:
NP_000006
Nucleotide Accession #:
NM_000015
Alias Symbols:
AAC2, PNAT
Replacement Item:
This antibody may replace item sc-134399 from Santa Cruz Biotechnology.
Description of Target:
NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.This gene encodes N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near NAT2.
Protein Size (# AA):
290
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NAT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NAT2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NAT2
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-NAT2 (ARP44195_T100)
Peptide Sequence:
Synthetic peptide located within the following region: CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
APP; NAA10;
Blocking Peptide:
For anti-NAT2 (ARP44195_T100) antibody is Catalog # AAP44195 (Previous Catalog # AAPP11971)
Datasheets/Manuals:
Printable datasheet for anti-NAT2 (ARP44195_T100) antibody
Specificity:
Antibody reacts with both NAT1 and NAT2
Target Reference:
Tamer,L., (2006) Cell Biochem. Funct. 24 (2), 131-135

Tell us what you think about this item!

Write A Review
    Please, wait...