Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NAGS antibody - C-terminal region (ARP51183_T100)

100 ul
$229.00
In Stock

Conjugation Options

ARP51183_T100-FITC Conjugated

ARP51183_T100-HRP Conjugated

ARP51183_T100-Biotin Conjugated

Gene Symbol:
NAGS
NCBI Gene Id:
162417
Official Gene Full Name:
N-acetylglutamate synthase
Protein Name:
N-acetylglutamate synthase, mitochondrial
Swissprot Id:
Q8N159
Protein Accession #:
NP_694551
Nucleotide Accession #:
NM_153006
Alias Symbols:
AGAS, ARGA, MGC133025
Replacement Item:
This antibody may replace item sc-102033 from Santa Cruz Biotechnology.
Description of Target:
NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.
Protein Size (# AA):
534
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NAGS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NAGS.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NAGS
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-NAGS (ARP51183_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TMEM39B;
Blocking Peptide:
For anti-NAGS (ARP51183_T100) antibody is Catalog # AAP51183 (Previous Catalog # AAPP28052)
Datasheets/Manuals:
Printable datasheet for anti-NAGS (ARP51183_T100) antibody
Target Reference:
Schmidt,E., (2005) Biochim. Biophys. Acta 1740 (1), 54-59

Tell us what you think about this item!

Write A Review
    Please, wait...