Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MYT1 antibody - N-terminal region (ARP32711_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32711_P050-FITC Conjugated

ARP32711_P050-HRP Conjugated

ARP32711_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Myelin transcription factor 1
Protein Name:
Myelin transcription factor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C20orf36, MTF1, MYTI, PLPB1
Replacement Item:
This antibody may replace item sc-74523 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing ne
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYT1.
The immunogen is a synthetic peptide directed towards the N terminal region of human MYT1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-MYT1 (ARP32711_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MYT1 (ARP32711_P050) antibody is Catalog # AAP32711 (Previous Catalog # AAPP03725)
Printable datasheet for anti-MYT1 (ARP32711_P050) antibody
Target Reference:
Vana,A.C., (2007) Glia 55 (7), 687-697

Tell us what you think about this item!

Write A Review
    Please, wait...