Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MYO10 antibody - C-terminal region (ARP64209_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP64209_P050-FITC Conjugated

ARP64209_P050-HRP Conjugated

ARP64209_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MYO10
NCBI Gene Id:
4651
Official Gene Full Name:
Myosin X
Protein Name:
cDNA FLJ90236 fis, clone NT2RM2000589, moderately similar to Bos taurus myosin X EMBL BAC11158.1
Swissprot Id:
Q8NCI3
Protein Accession #:
BAC11158
Nucleotide Accession #:
NM_012334
Alias Symbols:
-
Description of Target:
This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.
Protein Size (# AA):
984
Molecular Weight:
110kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYO10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYO10.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
Complete computational species homology data:
Anti-MYO10 (ARP64209_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PAN2; CAND1; KIAA0368; PRKCI; TERF2; FBXW11; PLA2G10; DYNLL1; ITGB5; CALML3; CALM1; ACTA1; CALM3; ITGB1; ITGB3;
Blocking Peptide:
For anti-MYO10 (ARP64209_P050) antibody is Catalog # AAP64209
Datasheets/Manuals:
Printable datasheet for anti-MYO10 (ARP64209_P050) antibody
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...