Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MUC1 antibody - middle region (ARP41456_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41456_P050-FITC Conjugated

ARP41456_P050-HRP Conjugated

ARP41456_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mucin 1, cell surface associated
Protein Name:
Mucin short variant PC2 EMBL AAP97027.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-15333, HPA008855
Description of Target:
MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC1.
The immunogen is a synthetic peptide directed towards the middle region of human MUC1
Species Reactivity:
Human, Pig
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-MUC1 (ARP41456_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MUC1 (ARP41456_P050) antibody is Catalog # AAP41456 (Previous Catalog # AAPP24193)
Printable datasheet for anti-MUC1 (ARP41456_P050) antibody
Target Reference:
Creaney,J., (2008) Br. J. Cancer 98 (9), 1562-1569

Tell us what you think about this item!

Write A Review
    Please, wait...