Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MUC1 antibody - middle region (ARP41456_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41456_P050-FITC Conjugated

ARP41456_P050-HRP Conjugated

ARP41456_P050-Biotin Conjugated

Gene Symbol:
MUC1
NCBI Gene Id:
4582
Official Gene Full Name:
Mucin 1, cell surface associated
Protein Name:
Mucin short variant PC2 EMBL AAP97027.1
Swissprot Id:
Q7Z538
Protein Accession #:
NP_001037858
Nucleotide Accession #:
NM_001044393
Alias Symbols:
CD227, EMA, H23AG, MAM6, PEM, PEMT, PUM, KL-6, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC
Replacement Item:
This antibody may replace item sc-15333, HPA008855
Description of Target:
MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.
Protein Size (# AA):
158
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MUC1
Species Reactivity:
Human, Pig
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-MUC1 (ARP41456_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PPARG; IPO5; NUP62; EGFR; ABL1; SRC; JUN; TP53; TBP; IKBKG; TNFRSF1A; IKBKB; GRB2; ESR1; GALNT15; GALNT12; GALNT10; OSGEP; GSK3B; GALNT2; GALNT1; CTNND1; SIGLEC1; ERBB4; ERBB3; SOS1; PRKCD; ZAP70; APC; JUP; LYN; ERBB2; LCK; CTNNB1; GALNT4; BAX; CDKN1
Blocking Peptide:
For anti-MUC1 (ARP41456_P050) antibody is Catalog # AAP41456 (Previous Catalog # AAPP24193)
Datasheets / Downloads:
Printable datasheet for anti-MUC1 (ARP41456_P050) antibody
Target Reference:
Creaney,J., (2008) Br. J. Cancer 98 (9), 1562-1569

Customer Reviews for MUC1 Antibody (ARP41456_P050) tested with NMuFG cells in Immunohistochemistry

CAT#ARP41456

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

Dilutions 1:50 for the three primary antibodies and 1:100 for FITC-conjugated secondary.

How did you store the antibody after re-suspension?

4 degree Celsius.

How would you rate this antibody on a scale from 1-5? Why?

"I would rate them a 5 as they compared to MUC4 from another company"

Would you use this antibody in future experiments?

Yes

Have you used another antibody which has worked in your application?

Not for Muc1, but for Muc4.

Submitted By:
JIll Trendel
University of Toledo

Product Protocols: MUC1 antibody tested with Human Jurkat Cells (ARP41456_P050)

Aviva Systems Biology is the original manufacturer of this MUC1 antibody (ARP41456_P050)

Click here to view the MUC1 antibody Western Blot Protocol

Product Datasheet Link: MUC1 antibody (ARP41456_P050)

WB Suggested Anti-MUC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MUC1 antibody (ARP41456_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...