Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MUC1 antibody - C-terminal region (ARP41445_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41445_P050-FITC Conjugated

ARP41445_P050-HRP Conjugated

ARP41445_P050-Biotin Conjugated

Gene Symbol:
MUC1
NCBI Gene Id:
4582
Official Gene Full Name:
Mucin 1, cell surface associated
Protein Name:
Mucin-1
Swissprot Id:
Q7Z552
Protein Accession #:
NP_001037855
Nucleotide Accession #:
NM_001044390
Alias Symbols:
CD227, EMA, PEM, PUM, mucin, KL-6, MAM6, PEMT, H23AG, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC
Replacement Item:
This antibody may replace item sc-15333, HPA008855
Description of Target:
MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Protein Size (# AA):
203
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Pig
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MUC1 (ARP41445_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PPARG; IPO5; NUP62; EGFR; ABL1; SRC; JUN; TP53; TBP; IKBKG; TNFRSF1A; IKBKB; GRB2; ESR1; GALNT15; GALNT12; GALNT10; OSGEP; GSK3B; GALNT2; GALNT1; CTNND1; SIGLEC1; ERBB4; ERBB3; SOS1; PRKCD; ZAP70; APC; JUP; LYN; ERBB2; LCK; CTNNB1; GALNT4; BAX; CDKN1
Blocking Peptide:
For anti-MUC1 (ARP41445_P050) antibody is Catalog # AAP41445 (Previous Catalog # AAPP24182)
Datasheets/Manuals:
Printable datasheet for anti-MUC1 (ARP41445_P050) antibody
Average Rating:
2 reviews
5 star
2
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: MUC1 antibody - C-terminal region (ARP41445_P050) in Human stomach using IHC
Product page for MUC1 antibody - C-terminal region (ARP41445_P050)

Researcher: Dr. Sara Linden, University of Gothenburg
Application: IHC
Species + Tissue/Cell type: Human stomach
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? In applications for immunohistochemistry. We were testing antibodies for MUC1 detection in swine samples.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Tested 3 antibodies and obtained better MUC1 detection with this one.
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because it meets our goal.
How did you store the antibody after re-suspension? 4 degree C
Sample Description (please include species type and tissue/cell type): Swine and human stomach
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? formalin
How many different experimental trials were conducted using the antibody sample? Three
Primary antibody dilution, incubation time and temperature: 1 ug\ml, 0.5 ug\ml, and 0.2 ug\ml,1 hour, room temp.
Secondary antibody used, dilution, incubation time and temperature: super picture HRP polymer conjugate, 10 min, room temp.
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Muc1 stain is brown, blue counterstain with hematoxilin.
Did you use an antigen retrieval method? If so, please explain? Antigen retrieval at high pH for 30 min.
What controls were used in your experiment? Human stomach
Please include your detailed tissue preparation and staining procedure/protocol here: Tissue preparation: formaline 36h, diH2O 30 min., ethanol 50%, ethanol 70% at least 30 min.
Paraffinizing: Ethanol 70% 2 h, 80% 1 h, 90% 1 h, 95% 1 h, 100% 1 h,100% 1 h,100% 1h, xylene 45 min, xylene 45 min, paraffin 1h, paraffin 1 h, paraffin 1 h, paraffin 1 h.
Parffin embeded blocks
Dewax: XtraSolv 10 min (x3), AbsEtOH 2 min (x2),EtOH 95% 2 min, EtOH 70% 2 min, diH2O 2 min.
Antigen retrieval at high pH, 30 min, 99C
Inhibition of endogenous peroxidase with 3% H2O2 for 10 min.
PBST washblock unsspecific binding with serum free protein block 30 min.
Primary antibody 1 h.
PBST wash (x3)
Secondary antibody super picture HRP polymer conjugate 10 min.
PBST wash (x3)
DAB solution 10 min.
diH2O wash (x3)
Counterstain with hematoxilin 1 min.
Dehydration: EtOH 70% 2 min, EtOH 95% 2 min, Abs EtOH 2 min, isopropanol 2 min.
Mount
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: MUC1 antibody - C-terminal region (ARP41445_P050) in Pig stomach using IHC
Product page for MUC1 antibody - C-terminal region (ARP41445_P050)

Researcher: Dr. Sara Linden, University of Gothenburg
Application: IHC
Species + Tissue/Cell type: Pig stomach
Primary antibody dilution: 1:5000 + 1:2000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? In applications for immunohistochemistry. We were testing antibodies for MUC1 detection in swine samples.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Tested 3 antibodies and obtained better MUC1 detection with this one.
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because it meets our goal.
How did you store the antibody after re-suspension? 4 degree C
Sample Description (please include species type and tissue/cell type): Swine and human stomach
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? formalin
How many different experimental trials were conducted using the antibody sample? Three
Primary antibody dilution, incubation time and temperature: 1 ug\ml, 0.5 ug\ml, and 0.2 ug\ml,1 hour, room temp.
Secondary antibody used, dilution, incubation time and temperature: super picture HRP polymer conjugate, 10 min, room temp.
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Muc1 stain is brown, blue counterstain with hematoxilin.
Did you use an antigen retrieval method? If so, please explain? Antigen retrieval at high pH for 30 min.
What controls were used in your experiment? Human stomach
Please include your detailed tissue preparation and staining procedure/protocol here: Tissue preparation: formaline 36h, diH2O 30 min., ethanol 50%, ethanol 70% at least 30 min.
Paraffinizing: Ethanol 70% 2 h, 80% 1 h, 90% 1 h, 95% 1 h, 100% 1 h,100% 1 h,100% 1h, xylene 45 min, xylene 45 min, paraffin 1h, paraffin 1 h, paraffin 1 h, paraffin 1 h.
Parffin embeded blocks
Dewax: XtraSolv 10 min (x3), AbsEtOH 2 min (x2),EtOH 95% 2 min, EtOH 70% 2 min, diH2O 2 min.
Antigen retrieval at high pH, 30 min, 99C
Inhibition of endogenous peroxidase with 3% H2O2 for 10 min.
PBST washblock unsspecific binding with serum free protein block 30 min.
Primary antibody 1 h.
PBST wash (x3)
Secondary antibody super picture HRP polymer conjugate 10 min.
PBST wash (x3)
DAB solution 10 min.
diH2O wash (x3)
Counterstain with hematoxilin 1 min.
Dehydration: EtOH 70% 2 min, EtOH 95% 2 min, Abs EtOH 2 min, isopropanol 2 min.
Mount
0
0
Reply
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...