Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MSH2 antibody - N-terminal region (ARP41351_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41351_P050-FITC Conjugated

ARP41351_P050-HRP Conjugated

ARP41351_P050-Biotin Conjugated

Gene Symbol:
MSH2
NCBI Gene Id:
4436
Official Gene Full Name:
MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
Protein Name:
DNA mismatch repair protein Msh2
Swissprot Id:
P43246
Protein Accession #:
NP_000242
Nucleotide Accession #:
NM_000251
Alias Symbols:
COCA1, FCC1, HNPCC, HNPCC1, LCFS2
Replacement Item:
This antibody may replace item sc-18388 from Santa Cruz Biotechnology.
Description of Target:
MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
934
Molecular Weight:
105kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MSH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MSH2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-MSH2 (ARP41351_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ESR1; BRCA1; SUMO2; RPA3; RPA2; RPA1; REV1; POLK; DPYSL3; ATP6V1B2; CUL2; XRCC5; SUPT5H; STAT3; ST13; PDE3A; NRD1; JUP; XRCC6; SEC23A; HDAC6; PCNA; MSH3; MSH6; ERCC4; ERCC1; gag-pol; UBC; SUPT16H; SEPT9; SRSF10; SRSF11; SART1; SMARCA5; TOP2B; SRSF7; SRSF5
Blocking Peptide:
For anti-MSH2 (ARP41351_P050) antibody is Catalog # AAP41351 (Previous Catalog # AAPS01510)
Datasheets/Manuals:
Printable datasheet for anti-MSH2 (ARP41351_P050) antibody
Target Reference:
Magnusson,S., (er) Fam. Cancer (2008) In press
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...