Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MSH2 antibody - N-terminal region (ARP41351_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41351_P050-FITC Conjugated

ARP41351_P050-HRP Conjugated

ARP41351_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
Protein Name:
DNA mismatch repair protein Msh2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-18388 from Santa Cruz Biotechnology.
Description of Target:
MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MSH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MSH2.
The immunogen is a synthetic peptide directed towards the N terminal region of human MSH2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-MSH2 (ARP41351_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MSH2 (ARP41351_P050) antibody is Catalog # AAP41351 (Previous Catalog # AAPS01510)
Printable datasheet for anti-MSH2 (ARP41351_P050) antibody
Target Reference:
Magnusson,S., (er) Fam. Cancer (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...