Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MRO antibody - C-terminal region (ARP60588_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP60588_P050-FITC Conjugated

ARP60588_P050-HRP Conjugated

ARP60588_P050-Biotin Conjugated

Gene Symbol:
MRO
NCBI Gene Id:
83876
Official Gene Full Name:
Maestro
Protein Name:
Protein maestro Ensembl ENSP00000397900
Swissprot Id:
E9PAT5
Protein Accession #:
NP_001120648
Nucleotide Accession #:
NM_001127176
Alias Symbols:
B29, C18orf3, FLJ30140
Replacement Item:
This antibody may replace item sc-134943 from Santa Cruz Biotechnology.
Description of Target:
This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination.
Protein Size (# AA):
262
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRO.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRO.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MRO
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 90%; Rabbit: 85%; Rat: 77%
Complete computational species homology data:
Anti-MRO (ARP60588_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MRO (ARP60588_P050) antibody is Catalog # AAP60588 (Previous Catalog # AAPP46628)
Datasheets/Manuals:
Printable datasheet for anti-MRO (ARP60588_P050) antibody
Publications:

Kenigsberg, S; Lima, PD; Maghen, L; Wyse, BA; Lackan, C; Cheung, AN; Tsang, BK; Librach, CL; The elusive MAESTRO gene: Its human reproductive tissue-specific expression pattern. 12, e0174873 (2017). WB, Cow, Dog, Horse, Human, Mouse, Rabbit, Rat 28406912

Tell us what you think about this item!

Write A Review
    Please, wait...