Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MMP3 antibody - middle region (ARP42041_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42041_P050-FITC Conjugated

ARP42041_P050-HRP Conjugated

ARP42041_P050-Biotin Conjugated

Gene Symbol:
MMP3
NCBI Gene Id:
4314
Official Gene Full Name:
Matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Protein Name:
Stromelysin-1
Swissprot Id:
P28862
Protein Accession #:
NP_002413
Nucleotide Accession #:
NM_002422
Alias Symbols:
CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1
Replacement Item:
This antibody may replace item sc-21732, HPA007875
Description of Target:
MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.
Protein Size (# AA):
477
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MMP3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 79%
Complete computational species homology data:
Anti-MMP3 (ARP42041_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MEOX2; SPOCK3; SPOCK1; TNFSF11; CCL8; CCL13; BCAN; TIMP1; TIMP3; MMP3; SERPINE1; PLG; SPP1; CCL7; CCL2; ACAN; IGFBP3; DCN; HAPLN1;
Blocking Peptide:
For anti-MMP3 (ARP42041_P050) antibody is Catalog # AAP42041 (Previous Catalog # AAPP24522)
Datasheets/Manuals:
Printable datasheet for anti-MMP3 (ARP42041_P050) antibody
 
X
Ask a Question
Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: MMP3 antibody - middle region (ARP42041_P050) in Human small intestine and Human colorectal cancer sample using IHC
Product Page for MMP3 antibody - middle region (ARP42041_P050)

Researcher: Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile
Application: IHC
Species + Tissue/Cell type: Control-Human small intestine, Sample-human colorectal cancer
Primary antibody dilution: 1:100
Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP



Questionnaire:
How do Aviva's reagents play a role in your experimental goals? We are analyzing the expression of the different metalloproteinases in primary colo-rectal cancer and the association with circulating tumor cells, thus we were pleased to participate in your sample program.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5-specific with no background staining or cross reactivity.
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? No.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? We plan to publish the data.
How did you store the antibody after re-suspension? 4 degree C.
What controls were used in your experiment? Please include your positive control: Control: small intestine Sample: Primary colo-rectal cancer
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? 10% formalin, buffered with PBS to pH 7.2 for 12 hours.
How many different experimental trials were conducted using the antibody sample? 30 different patients.
Primary antibody dilution, incubation time and temperature: Dilution 1:100, 1 h incubation at RT
Secondary antibody used, dilution, incubation time and temperature: LSAB commercial kit (DAKO USA) ready to use; 10 minutes, room temperature.
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: DAB as the chromogen and Harris's Haematoxilin as counterstain.
Did you use an antigen retrieval method? If so, please explain? Citrate retrival, PH 6.0 en Pascal Pressure cooker for 15 minutes at 96 degree C.
What controls were used in your experiment? Please include your positive control: Small intestine.
Experimental Procedure/Protocols: Tissues were fixed in 10% formalin buffered with PBS to pH 7.2 and left for 12 hours and then embedded in parafin. # um sections were cut and put onto sialinized slides (DAKO, USA). Sections were deparafinized using Xylol and decreasing concentrations of alcohol. Antigen retrieval using a commercial citrate pH 6.0 solution (DAKO, USA) at 96 degree C for 15 minutes in a pressure cooker. Primary antibody in a dilution of 1:100 for 1 h at RT, then washed 3 times with PBS pH 7.2, secondary antibody with streptoavdin-biotin (LSAB-HRP DAKO USA) according to manufecterer's instructions with DAB as the chromagen. Counterstaining with haematoxilin de harris for 2 minutes at room temperature was then performed. Slides were washed and mounted. Control slides were classified as 3+ and samples as 0=no staining, 1=weak straining, 2=moderate staining and 3=strong staining.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...