Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MMP2 antibody - C-terminal region (AVARP20016_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP20016_T100-FITC Conjugated

AVARP20016_T100-HRP Conjugated

AVARP20016_T100-Biotin Conjugated

Gene Symbol:
MMP2
NCBI Gene Id:
4313
Official Gene Full Name:
Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Protein Name:
72 kDa type IV collagenase
Swissprot Id:
P08253
Protein Accession #:
NP_004521
Nucleotide Accession #:
NM_004530
Alias Symbols:
CLG4, MONA, CLG4A, TBE-1, MMP-II
Replacement Item:
This antibody may replace item sc-10736, HPA001939
Description of Target:
MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Protein Size (# AA):
660
Molecular Weight:
74kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-MMP2 (AVARP20016_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSP90AA1; CAND1; ITGB1; ITGAV; USP12; OSBPL10; SPOCK1; BACE1; PZP; MMP25; CLDN1; KISS1; MMP17; TIMP4; EPHB2; CXCL12; MMP14; BCAN; LCN2; TIMP1; TGFB1; TIMP3; TIMP2; THBS2; THBS1; CCL7; ACAN; LGALS3; IL1B; IGFBP3; FGFR1; DCN; COL18A1; COL6A3; COL1A1; COL7A1
Blocking Peptide:
For anti-MMP2 (AVARP20016_T100) antibody is Catalog # AAP30579 (Previous Catalog # AAPP01231)
Datasheets/Manuals:
Printable datasheet for anti-MMP2 (AVARP20016_T100) antibody
Target Reference:
Collier, I.E., et al., (1988) J. Biol. Chem. 263:6579-6587.
Publications:

Puttabyatappa, M; Irwin, A; Martin, JD; Mesquitta, M; Veiga-Lopez, A; Padmanabhan, V; Developmental Programming: Gestational Exposure to Excess Testosterone Alters Expression of Ovarian Matrix Metalloproteases and Their Target Proteins. 1933719117697127 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28299992

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: MMP2 antibody-C-terminal region (AVARP20016_T100) in MDA-MB-231 and MCF7 breast cancer cell line using Western blot
Product Page for MMP2 antibody-C-terminal region (AVARP20016_T100)

Researcher: Katarzyna Augoff, University of Wroclaw
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 15ug MDA-MB-231 lysate Lane 2: 15ug MCF7 lysate cancer cell line
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:10,000


Questionnaire:
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Please include your detailed WB Procedure/Protocol here: WB Samples: cell lysate (Protein 15 ug/well)
1-MDA-MB-231
2-MCF-7
Primary antibody: DPP4, 1:100 in PBS-T(overnight 4 degree C)
Secondary antibody: Donkey anti-rabbit IgG-HRP, 1:10 000 in 1% milk in PBS-T - 1h /RT
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...