Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MMP2 antibody - C-terminal region (AVARP20016_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP20016_T100-FITC Conjugated

AVARP20016_T100-HRP Conjugated

AVARP20016_T100-Biotin Conjugated

Gene Symbol:
MMP2
NCBI Gene Id:
4313
Official Gene Full Name:
Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Protein Name:
72 kDa type IV collagenase
Swissprot Id:
P08253
Protein Accession #:
NP_004521
Nucleotide Accession #:
NM_004530
Alias Symbols:
CLG4, MONA, CLG4A, TBE-1, MMP-II
Replacement Item:
This antibody may replace item sc-10736, HPA001939
Description of Target:
MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Protein Size (# AA):
660
Molecular Weight:
74kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-MMP2 (AVARP20016_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSP90AA1; CAND1; ITGB1; ITGAV; USP12; OSBPL10; SPOCK1; BACE1; PZP; MMP25; CLDN1; KISS1; MMP17; TIMP4; EPHB2; CXCL12; MMP14; BCAN; LCN2; TIMP1; TGFB1; TIMP3; TIMP2; THBS2; THBS1; CCL7; ACAN; LGALS3; IL1B; IGFBP3; FGFR1; DCN; COL18A1; COL6A3; COL1A1; COL7A1
Blocking Peptide:
For anti-MMP2 (AVARP20016_T100) antibody is Catalog # AAP30579 (Previous Catalog # AAPP01231)
Datasheets / Downloads:
Printable datasheet for anti-MMP2 (AVARP20016_T100) antibody
Target Reference:
Collier, I.E., et al., (1988) J. Biol. Chem. 263:6579-6587.
Publications:

Puttabyatappa, M; Irwin, A; Martin, JD; Mesquitta, M; Veiga-Lopez, A; Padmanabhan, V; Developmental Programming: Gestational Exposure to Excess Testosterone Alters Expression of Ovarian Matrix Metalloproteases and Their Target Proteins. 1933719117697127 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28299992

Customer Reviews for MMP2 Antibody (AVARP20016_T100) tested with human ovarian carcinoma in Immunohistochemistry

CAT#: AVARP20016
submitted by:
Galina
MVS

Immunohistochemistry Protocol:

Antibodies were tested in the range of 2- 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat. Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacturer's recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using anti-fade mounting media  with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Product Protocol: MMP2 Antibody (AVARP20016_T100) in Human Urinary Bladder Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this MMP2 antibody.
Product Datasheet Link: MMP2 antibody AVARP20016_T100

Rabbit Anti-MMP2 Antibody
Catalog Number: AVARP20016_T100
Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, MMP2 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

Protocol:
1. Normal adult human urinary bladder tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human urinary bladder tissue.

 
X
Ask a Question
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: MMP2 antibody-C-terminal region (AVARP20016_T100) in MDA-MB-231 and MCF7 breast cancer cell line using Western blot
Product Page for MMP2 antibody-C-terminal region (AVARP20016_T100)

Researcher: Katarzyna Augoff, University of Wroclaw
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 15ug MDA-MB-231 lysate Lane 2: 15ug MCF7 lysate cancer cell line
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:10,000


Questionnaire:
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Please include your detailed WB Procedure/Protocol here: WB Samples: cell lysate (Protein 15 ug/well)
1-MDA-MB-231
2-MCF-7
Primary antibody: DPP4, 1:100 in PBS-T(overnight 4 degree C)
Secondary antibody: Donkey anti-rabbit IgG-HRP, 1:10 000 in 1% milk in PBS-T - 1h /RT
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...