Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MMP2 antibody - C-terminal region (AVARP20016_T100)

Print Page
100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP20016_T100-FITC Conjugated

AVARP20016_T100-HRP Conjugated

AVARP20016_T100-Biotin Conjugated

Gene Symbol:
MMP2
NCBI Gene Id:
4313
Official Gene Full Name:
Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Protein Name:
72 kDa type IV collagenase
Swissprot Id:
P08253
Protein Accession #:
NP_004521
Nucleotide Accession #:
NM_004530
Alias Symbols:
CLG4, MONA, CLG4A, TBE-1, MMP-II
Replacement Item:
This antibody may replace item sc-10736, HPA001939
Description of Target:
MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Protein Size (# AA):
660
Molecular Weight:
74kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-MMP2 (AVARP20016_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSP90AA1; CAND1; ITGB1; ITGAV; USP12; OSBPL10; SPOCK1; BACE1; PZP; MMP25; CLDN1; KISS1; MMP17; TIMP4; EPHB2; CXCL12; MMP14; BCAN; LCN2; TIMP1; TGFB1; TIMP3; TIMP2; THBS2; THBS1; CCL7; ACAN; LGALS3; IL1B; IGFBP3; FGFR1; DCN; COL18A1; COL6A3; COL1A1; COL7A1
Blocking Peptide:
For anti-MMP2 (AVARP20016_T100) antibody is Catalog # AAP30579 (Previous Catalog # AAPP01231)
Datasheets/Manuals:
Printable datasheet for anti-MMP2 (AVARP20016_T100) antibody
Target Reference:
Collier, I.E., et al., (1988) J. Biol. Chem. 263:6579-6587.
Publications:

Puttabyatappa, M; Irwin, A; Martin, JD; Mesquitta, M; Veiga-Lopez, A; Padmanabhan, V; Developmental Programming: Gestational Exposure to Excess Testosterone Alters Expression of Ovarian Matrix Metalloproteases and Their Target Proteins. 1933719117697127 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28299992

 
X
Ask a Question
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: MMP2 antibody-C-terminal region (AVARP20016_T100) in MDA-MB-231 and MCF7 breast cancer cell line using Western blot
Product Page for MMP2 antibody-C-terminal region (AVARP20016_T100)

Researcher: Katarzyna Augoff, University of Wroclaw
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 15ug MDA-MB-231 lysate Lane 2: 15ug MCF7 lysate cancer cell line
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:10,000


Questionnaire:
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Please include your detailed WB Procedure/Protocol here: WB Samples: cell lysate (Protein 15 ug/well)
1-MDA-MB-231
2-MCF-7
Primary antibody: DPP4, 1:100 in PBS-T(overnight 4 degree C)
Secondary antibody: Donkey anti-rabbit IgG-HRP, 1:10 000 in 1% milk in PBS-T - 1h /RT
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...