Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MMP1 antibody - N-terminal region (ARP42039_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42039_T100-FITC Conjugated

ARP42039_T100-HRP Conjugated

ARP42039_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Matrix metallopeptidase 1 (interstitial collagenase)
Protein Name:
Interstitial collagenase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-12348 from Santa Cruz Biotechnology.
Description of Target:
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP1.
The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
Species Reactivity:
Horse, Human
Predicted Homology Based on Immunogen Sequence:
Horse: 77%; Human: 100%
Complete computational species homology data:
Anti-MMP1 (ARP42039_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MMP1 (ARP42039_T100) antibody is Catalog # AAP42039 (Previous Catalog # AAPP24520)
Printable datasheet for anti-MMP1 (ARP42039_T100) antibody
Target Reference:
Montero,I., (2006) J. Am. Coll. Cardiol. 47 (7), 1369-1378
Average Rating:
2 reviews
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: MMP1 antibody - N-terminal region (ARP42039_T100) in Human liver and Human colorectal cancer sample using IHC
Product Page for MMP1 antibody - N-terminal region (ARP42039_T100)

Researcher: Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile
Application: IHC
Species + Tissue/Cell type: Control-Human liver, Sample-human colorectal cancer
Primary antibody dilution: 1:100
Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP

How do Aviva's reagents play a role in your experimental goals? We are analyzing the expression of the different metalloproteinases in primary colo-rectal cancer and the association with circulating tumor cells, thus we were pleased to participate in your sample program.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5-specific, with no background cross reacting or cross reactivity.
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? No this is our first time using anti-VEGF-R antibodies.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? We plan to publish our data in the near future.
How did you store the antibody after re-suspension? 4 degree C.
What controls were used in your experiment? Please include your positive control: Control: liver Sample: Primary colo-rectal cancer
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? 10% formalin, buffered with PBS to pH 7.2 for 12 hours.
How many different experimental trials were conducted using the antibody sample? 30 different patients.
Primary antibody dilution, incubation time and temperature: Dilution 1:100, 1 h incubation, RT
Secondary antibody used, dilution, incubation time and temperature: LSAB commercial kit (DAKO USA) ready to use; 10 minutes, room temperature.
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: DAB as the chromogen and Haematoxilin de Harris as counterstain.
Did you use an antigen retrieval method? If so, please explain? Citrate retrival, PH 6.0 en Pascal Pressure cooker for 15 minutes at 96 degree C.
What controls were used in your experiment? Please include your positive control: Placental tissue
Experimental Procedure/Protocols: Tissues were fixed in 10% formalin buffered with PBS to pH 7.2 and left for 12 hours and then embedded in parafin. # um sections were cut and put onto sialinized slides (DAKO, USA). Sections were deparafinized using Xylol and decreasing concentrations of alcohol. Antigen retrieval using a commercial citrate pH 6.0 solution (DAKO, USA) at 96 degree C for 15 minutes in a pressure cooker. Primary antibody in a dilution of 1:100 for 1 h at RT, then washed 3 times with PBS pH 7.2, secondary antibody with streptoavdin-biotin (LSAB-HRP DAKO USA) according to manufecterer's instructions with DAB as the chromagen. Counterstaining with haematoxilin de harris for 2 minutes at room temperature was then performed. Slides were washed and mounted. Control slides were classified as 3+ and samples as 0=no staining, 1=weak straining, 2=moderate staining and 3=strong staining.
Show more comments (-2) Hide comments
02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: MMP1 antibody - N-terminal region (ARP42039_T100) in HT29 cell lysate using Western blot
Product Page for MMP1 antibody - N-terminal region (ARP42039_T100)

Researcher: Zhongsheng Peng, School of Medicine, University of Maryland Baltimore
Application: Western blotting
Species + Tissue/Cell type:
Lane 1: 15ug HT29 cell lysate
Lane 2: 15ug HT29 cell lysate
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:2000

 How do Aviva's reagents play a role in your experimental goals? This antibody plays a crucial role in my experiments.
 How would you rate this antibody on a scale from 1-5 (5=best) nad why? 4
 Would you use this antibody in future experiment? Yes.
 Have you used another antibody which has worked in your application? No.
 Do you believe the information about the reagent on Aviva's website is correct? Correct.
 If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, we plan to use this antibody in future experiments.
 How did you store the antibody after re-suspension? Aliquot.
 Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Cancer cell line, toad 1Sug protein for each lane.
 How many different experimental trials were conducted using the antibody sample? Two exOelmeltal trials.
 How was this sample prepared? 1. Aspirate media from orltures; wash cells with 1X PBS; aspirate.
2. Add Rl pA buffer wjth proteinase inhibitors (sigma), immediately scrape the cells off the plate and transferthe extract to a microcentrifuge tube. Keep on ice
3. Sonicate for 10- 15 seconds.
4. Centrifgue 15,0009 for 10 minutes, transfer liquid to dean microcentrifuge tubes
5. l\,4easu re protein concentration with BCA protein assay kit (Thermo Scientific , prod # 23227).
O. Mix samples with Bio-rad loading buffer (with 2-mercap). Boil samples for 5 minutes, and cool down samples on ice for 5 minutes.
 Primary antibody dilution and incubation time: Dilute: 1:500 and overnight incubation.
 Secondary antibody used and dilution and incubation time: Dilute: 1:2000 and incubate for t hour at room temperature.
 What controls were used in your experiment (positive/negative)? No positive and negative control.
 Please include your detailed WB Procedure/Protocol here: 1 . Aspirate media from cultures; wash cells with 1X PBS; aspirate.
2. Add RIPA buffer with proteinase inhibitors (sigma), immediately scrape the cells off the plate and transfer the extract to a
microcentrifuge tube. Keep on ice.
3. Sonicate for 10-15 seconds.
4. Centrifgue 15,000g for 10 minutes, transfer liquid to clean microcentrifuge tubes.
5. Measure protein concentration with BCA protein assay kit (Thermo Scientific, prod#23227).
6. Mix samples with Bio-rad loading buffer (with 2-mercap). Boil samples for 5 minutes, and cool down samples on ice for 5 minutes.
7. Load 10-20u9 protein to SDS-PAGE gel (lnvitrogen), Run gel for 1-2 hours.
8. Electrotransfer to nitrocell ulose membrane.
9. After transfer, membrane is incubated at 5%BSA for t hour.
10. Wash three times for 5 minutes with 0.1%tween TBS.
11. lncubate membrane and primary antibody with gentle agitation overnight at 4 d C.
12. Wash three times for 5 minutes with 0.1%tween TBS.
13. lncubate membrane with HRP-conjugated secondary antibody (1 :2000) in 5% BSA with gentle agitation for t hour at room
14. Wash five times for 5 minutes with 0.1%tween TBS.
15. lncubate membrane with SuperSignal West Pico Chemiluminescent Substrate for 1-5 minutes
16. Drain membrane of excess developing solution, wrap in plastic wrap and expose to x-ray.
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...