Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MCM8 antibody - N-terminal region (ARP36658_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP36658_P050-FITC Conjugated

ARP36658_P050-HRP Conjugated

ARP36658_P050-Biotin Conjugated

Gene Symbol:
MCM8
NCBI Gene Id:
84515
Official Gene Full Name:
Minichromosome maintenance complex component 8
Protein Name:
DNA helicase MCM8
Swissprot Id:
Q9UJA3
Protein Accession #:
NP_115874
Nucleotide Accession #:
NM_032485
Alias Symbols:
C20orf154, MGC119522, MGC119523, MGC12866, MGC4816, REC, dJ967N21.5
Replacement Item:
This antibody may replace item sc-47117 from Santa Cruz Biotechnology.
Description of Target:
This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
840
Molecular Weight:
94kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MCM8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MCM8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-MCM8 (ARP36658_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MCMBP; MCM4; MCM6; MCM7; ORC2; CDC6;
Blocking Peptide:
For anti-MCM8 (ARP36658_P050) antibody is Catalog # AAP36658 (Previous Catalog # AAPP07915)
Datasheets/Manuals:
Printable datasheet for anti-MCM8 (ARP36658_P050) antibody
Target Reference:
Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)

Tell us what you think about this item!

Write A Review
    Please, wait...