Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MARCH5 Antibody - C-terminal region (ARP43233_P050)

100 ul
In Stock

Conjugation Options

ARP43233_P050-FITC Conjugated

ARP43233_P050-HRP Conjugated

ARP43233_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Membrane-associated ring finger (C3HC4) 5
Protein Name:
E3 ubiquitin-protein ligase MARCH5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-109542 from Santa Cruz Biotechnology.
Description of Target:
MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L).MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MARCH5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MARCH5.
The immunogen is a synthetic peptide directed towards the C terminal region of human MARCH5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MARCH5 (ARP43233_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MARCH5 (ARP43233_P050) antibody is Catalog # AAP43233 (Previous Catalog # AAPP11308)
Printable datasheet for anti-MARCH5 (ARP43233_P050) antibody
Target Reference:
Karbowski,M., (2007) J. Cell Biol. 178 (1), 71-84

Tell us what you think about this item!

Write A Review
    Please, wait...