Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LRRFIP1 antibody - N-terminal region (ARP38506_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38506_P050-FITC Conjugated

ARP38506_P050-HRP Conjugated

ARP38506_P050-Biotin Conjugated

Gene Symbol:
LRRFIP1
NCBI Gene Id:
9208
Official Gene Full Name:
Leucine rich repeat (in FLII) interacting protein 1
Protein Name:
Leucine-rich repeat flightless-interacting protein 1
Swissprot Id:
Q32MZ4-2
Protein Accession #:
NP_004726
Nucleotide Accession #:
NM_004735
Alias Symbols:
FLAP-1, FLIIAP1, GCF-2, GCF2, HUFI-1, MGC10947, MGC119738, MGC119739, TRIP, FLAP1
Replacement Item:
This antibody may replace item sc-101168 from Santa Cruz Biotechnology.
Description of Target:
LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury throu
Protein Size (# AA):
784
Molecular Weight:
86kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRRFIP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRRFIP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRFIP1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 100%
Complete computational species homology data:
Anti-LRRFIP1 (ARP38506_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CEP44; MED4; UBC; LGR4; RNF2; C14orf166; RTCB; RPLP0; RFC2; PRKDC; MRE11A; FLII; EPRS; DHX9; DDX1; DPY30; FKBP3; DYNC1H1; Grip; GRIP1; EP300; CTNNB1; MYD88;
Blocking Peptide:
For anti-LRRFIP1 (ARP38506_P050) antibody is Catalog # AAP38506 (Previous Catalog # AAPS04402)
Datasheets/Manuals:
Printable datasheet for anti-LRRFIP1 (ARP38506_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Tell us what you think about this item!

Write A Review
    Please, wait...