Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LPHN1 Antibody - C-terminal region (ARP65781_P050)

100 ul
In Stock

Conjugation Options

ARP65781_P050-FITC Conjugated

ARP65781_P050-HRP Conjugated

ARP65781_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Latrophilin 1
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-34484 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LPHN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LPHN1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-LPHN1 (ARP65781_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LPHN1 (ARP65781_P050) antibody is Catalog # AAP65781
Printable datasheet for anti-LPHN1 (ARP65781_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...