Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LGALS1 antibody - middle region (ARP58491_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP58491_P050-FITC Conjugated

ARP58491_P050-HRP Conjugated

ARP58491_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Lectin, galactoside-binding, soluble, 1
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp686E23103, GBP, GAL1
Replacement Item:
This antibody may replace item sc-128680, HPA000646
Description of Target:
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LGALS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LGALS1.
The immunogen is a synthetic peptide directed towards the middle region of human LGALS1
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 93%; Sheep: 100%
Complete computational species homology data:
Anti-LGALS1 (ARP58491_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LGALS1 (ARP58491_P050) antibody is Catalog # AAP58491 (Previous Catalog # AAPP34713)
Printable datasheet for anti-LGALS1 (ARP58491_P050) antibody
Target Reference:
Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Tell us what you think about this item!

Write A Review
    Please, wait...