Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LGALS1 Antibody - middle region (ARP58491_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP58491_P050-FITC Conjugated

ARP58491_P050-HRP Conjugated

ARP58491_P050-Biotin Conjugated

Gene Symbol:
LGALS1
NCBI Gene Id:
3956
Official Gene Full Name:
galectin 1
Protein Name:
galectin-1
Swissprot Id:
P09382
Protein Accession #:
NP_002296
Nucleotide Accession #:
NM_002305
Alias Symbols:
GBP, GAL1
Replacement Item:
This antibody may replace item sc-128680, HPA000646
Description of Target:
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation.
Protein Size (# AA):
135
Molecular Weight:
15kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LGALS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LGALS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human LGALS1
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 93%; Sheep: 100%
Complete computational species homology data:
Anti-LGALS1 (ARP58491_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; HRAS; NEDD8; PSMG1; HIST1H2BO; APEX1; ACO1; FUBP1; EGFR; UBD; NPM1; VCAM1; MYC; ITGA4; FN1; GRDX; IGBP1; HSPA5; GTF2I; FLNA; CLNS1A; ALDOA; USP4; SUMO2; CDC42; Trim69; MUC16; GEMIN4; SPN; VPREB1; LGALS3BP; CD2; CD4; CD8A; CD7; PTPRC; ITGB1; GEMIN2; S
Blocking Peptide:
For anti-LGALS1 (ARP58491_P050) antibody is Catalog # AAP58491 (Previous Catalog # AAPP34713)
Datasheets/Manuals:
Printable datasheet for anti-LGALS1 (ARP58491_P050) antibody
Target Reference:
Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Tell us what you think about this item!

Write A Review
    Please, wait...