Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LDHA antibody - N-terminal region : HRP (ARP54776_P050-HRP)


Print Page
100 ul
In Stock

Conjugation Options

ARP54776_P050 Unconjugated

ARP54776_P050-FITC Conjugated

ARP54776_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Lactate dehydrogenase A
Protein Name:
L-lactate dehydrogenase A chain
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Description of Target:
LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDHA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-LDHA (ARP54776_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.6-0.7 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LDHA (ARP54776_P050-HRP) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Printable datasheet for anti-LDHA (ARP54776_P050-HRP) antibody
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Target Reference:
Listerman,I., PLoS Genet. 3 (11), E212 (2007)
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...