Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LDB2 antibody - N-terminal region (ARP33000_T100)

Scroll Horizontally to view all Images
Print Page
100 ul
$229.00
In Stock

Conjugation Options

ARP33000_T100-FITC Conjugated

ARP33000_T100-HRP Conjugated

ARP33000_T100-Biotin Conjugated

Gene Symbol:
LDB2
NCBI Gene Id:
9079
Official Gene Full Name:
LIM domain binding 2
Protein Name:
LIM domain-binding protein 2
Swissprot Id:
O43679
Protein Accession #:
NP_001281
Nucleotide Accession #:
NM_001290
Alias Symbols:
LDB1, CLIM1
Replacement Item:
This antibody may replace item sc-101088 from Santa Cruz Biotechnology.
Description of Target:
LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes.
Protein Size (# AA):
373
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LDB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LDB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LDB2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-LDB2 (ARP33000_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LHX4; RILP; LMO3; RASIP1; SSBP3; SSBP2; LMO4; TSNAX; UBC; SSBP4; ISL1; LHX9; RLIM;
Blocking Peptide:
For anti-LDB2 (ARP33000_T100) antibody is Catalog # AAP33000 (Previous Catalog # AAPP04029)
Datasheets/Manuals:
Printable datasheet for anti-LDB2 (ARP33000_T100) antibody
Target Reference:
Retaux,S., et al., (1999) J. Neurosci. 19 (2), 783-793
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...