Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Larval cuticle protein A1A Recombinant Protein (Yellow mealworm beetle) (OPCA04582)

$255.00
In Stock
Gene Symbol:
Larval cuticle protein A1A
Alias Symbols:
TM-LCP A1A Short name: TM-A1A
Description of Target:
Component of the cuticle of the larva of Tenebrio molitor.
Swissprot Id:
P80681
Protein Name:
Larval cuticle protein A1A
Molecular Weight:
25 kDa
Product Format:
Liquid
Species Reactivity:
Yellow mealworm beetle
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Tenebrio molitor (Yellow mealworm beetle)
Tag:
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Sequence studies of proteins from larval and pupal cuticle of the yellow meal worm, Tenebrio molitor.Andersen S.O., Rafn K., Roepstorff P.Insect Biochem. Mol. Biol. 27:121-131(1997)
Datasheets/Manuals:
Printable datasheet for OPCA04582
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...