Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ku80 Antibody (Phospho-Thr714) (OAAF07363)

100 ug
In Stock

Conjugation Options

OAAF07363-FITC Conjugated

OAAF07363-HRP Conjugated

OAAF07363-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
86 kDa subunit of Ku antigen, ATP-dependent DNA helicase II, 80 kDa subunit, CTC box binding factor 85 kDa subunit, CTC85, CTCBF, DNA-repair protein XRCC5, G22P2, KU86, Lupus Ku autoantigen protein p86, Nuclear factor IV, Thyroid- lupus autoanti
Replacement Item:
This antibody may replace item sc-135964 from Santa Cruz Biotechnology.
Molecular Weight:
82 kDa
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express XRCC5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express XRCC5.
The antiserum was produced against synthesized peptide derived from human Ku80 around the phosphorylation site of Thr714.
Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: ITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Printable datasheet for OAAF07363
Ku80 (Phospho-Thr714) Antibody detects endogenous levels of Ku80 only when phosphorylated at Thr714.
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:1000
Additional Information:
Modification Sites: Human:T714
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...