Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KDR antibody - N-terminal region (AVARP20010_P050)

Scroll Horizontally to view all Images

 

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP20010_P050-FITC Conjugated

AVARP20010_P050-HRP Conjugated

AVARP20010_P050-Biotin Conjugated

Gene Symbol:
KDR
NCBI Gene Id:
3791
Official Gene Full Name:
Kinase insert domain receptor (a type III receptor tyrosine kinase)
Protein Name:
Vascular endothelial growth factor receptor 2
Swissprot Id:
P35968
Protein Accession #:
NP_002244
Nucleotide Accession #:
NM_002253
Alias Symbols:
CD309, FLK1, VEGFR, VEGFR2
Replacement Item:
This antibody may replace item sc-19530 from Santa Cruz Biotechnology.
Description of Target:
KDR is the receptor for VEGF or VEGFC. It has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
Protein Size (# AA):
1356
Molecular Weight:
151kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KDR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KDR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KDR
Species Reactivity:
Cow, Dog, Horse, Human, Pig
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%
Complete computational species homology data:
Anti-KDR (AVARP20010_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FBXO25; VEGFA; MYO1C; CAV1; NPM1; EPN1; SRC; CBL; IQGAP1; UBC; CSNK1D; FBXW11; BTRC; CUL1; AIMP2; SHC2; SYNGAP1; ACP1; ATR; FRS2; SH2D2A; DNM2; NRP1; VEGFC; GRB10; CDH5; GNAQ; SHC1; STAT1; NCK1; SHB; PLCG2; P2RY2; BMX; FIGF; KDR; TIMP3; PTPN6; PTPN11; ITG
Blocking Peptide:
For anti-KDR (AVARP20010_P050) antibody is Catalog # AAP30576 (Previous Catalog # AAPP01228)
Datasheets/Manuals:
Printable datasheet for anti-KDR (AVARP20010_P050) antibody
Target Reference:
Ohsaka,A., (2008) Biochem. Biophys. Res. Commun. 368 (3), 543-549

Customer Reviews for KDR Antibody (AVARP20010_P050) tested with human placenta blood vessels in Immunohistochemistry

CAT#: AVARP20010

KDR Antibody
KDR Antibody IHC
KDR Antibody, rat and mouse tissues

Immunohistochemistry Protocol:

Antibodies were tested in the range of 2 – 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat. Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacture's recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using MVS Pacific anti-fade mounting media (available for OEM) with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Product Protocols: KDR antibody tested with Human Fetal Lung Tissue (AVARP20010_P050)

Aviva Systems Biology is the original manufacturer of this KDR antibody (AVARP20010_P050)

Click here to view the KDR antibody Western Blot Protocol

Product Datasheet Link: KDR antibody (AVARP20010_P050)

WB Suggested Anti-KDR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Lung

Western Blot image:


Description of Target: KDR is the receptor for VEGF or VEGFC. It has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KDR antibody (AVARP20010_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question
Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: KDR antibody - N-terminal region (AVARP20010_P050) in Human Placenta and Human colorectal cancer sample using IHC
Product Page for KDR antibody - N-terminal region (AVARP20010_P050)

Researcher: Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile
Application: IHC
Species + Tissue/Cell type: Control-Human Placenta, Sample-Human colorectal cancer
Primary antibody dilution: 1:100
Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP



Questionnaire:
How do Aviva's reagents play a role in your experimental goals? We are analyzing the expression of the different metalloproteinases in primary colo-rectal cancer and the association with circulating tumor cells, thus we were pleased to participate in your sample program.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5-specific with no background staining or cross reactivity.
Would you use this antibody in future experiments? Yes.
Have you used another antibody which has worked in your application? No this is our first time using anti-VEGF-R antibodies.
Do you believe the information about the reagent on Aviva's website is correct? Yes.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? We plan to publish our data in the near future.
How did you store the antibody after re-suspension? 4 degree C.
What controls were used in your experiment? Please include your positive control: Control: placenta Sample: Primary colo-rectal cancer
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? 10% formalin, buffered with PBS to pH 7.2 for 12 hours.
How many different experimental trials were conducted using the antibody sample? 30 different patients.
Primary antibody dilution, incubation time and temperature: Dilution 1:100, 1 h incubation at RT
Secondary antibody used, dilution, incubation time and temperature: LSAB commercial kit (DAKO USA) ready to use; 10 minutes, room temperature.
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: DAB as the chromogen and Harris's Haematoxilin as counterstain.
Did you use an antigen retrieval method? If so, please explain? Citrate retrival, PH 6.0 en Pascal Pressure cooker for 15 minutes at 96 degree C.
What controls were used in your experiment? Please include your positive control: Placental tissue.
Experimental Procedure/Protocols: Tissues were fixed in 10% formalin buffered with PBS to pH 7.2 and left for 12 hours and then embedded in parafin. # um sections were cut and put onto sialinized slides (DAKO, USA). Sections were deparafinized using Xylol and decreasing concentrations of alcohol. Antigen retrieval using a commercial citrate pH 6.0 solution (DAKO, USA) at 96 degree C for 15 minutes in a pressure cooker. Primary antibody in a dilution of 1:100 for 1 h at RT, then washed 3 times with PBS pH 7.2, secondary antibody with streptoavdin-biotin (LSAB-HRP DAKO USA) according to manufecterer's instructions with DAB as the chromagen. Counterstaining with haematoxilin de harris for 2 minutes at room temperature was then performed. Slides were washed and mounted. Control slides were classified as 3+ and samples as 0=no staining, 1=weak straining, 2=moderate staining and 3=strong staining.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...