Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KCNAB2 antibody - middle region (ARP37678_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP37678_P050-FITC Conjugated

ARP37678_P050-HRP Conjugated

ARP37678_P050-Biotin Conjugated

Gene Symbol:
KCNAB2
NCBI Gene Id:
8514
Official Gene Full Name:
Potassium voltage-gated channel, shaker-related subfamily, beta member 2
Protein Name:
Voltage-gated potassium channel subunit beta-2
Swissprot Id:
Q13303
Protein Accession #:
NP_003627
Nucleotide Accession #:
NM_003636
Alias Symbols:
AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2
Replacement Item:
This antibody may replace item sc-111792 from Santa Cruz Biotechnology.
Description of Target:
The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits.
Protein Size (# AA):
367
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNAB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNAB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Complete computational species homology data:
Anti-KCNAB2 (ARP37678_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KCNAB2; SIRT1; KCNA5; KCNA4; UBC; RPA3; RPA2; RPA1; ATXN1; Nedd4; NEDD4L; SLC39A2; SLC39A1; SQSTM1; CD4; KCNA2;
Blocking Peptide:
For anti-KCNAB2 (ARP37678_P050) antibody is Catalog # AAP37678 (Previous Catalog # AAPP09012)
Datasheets/Manuals:
Printable datasheet for anti-KCNAB2 (ARP37678_P050) antibody
Sample Type Confirmation:

KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Subunit:
beta-2
Target Reference:
Gu,C., et al., (2003) Science 301 (5633), 646-649

Tell us what you think about this item!

Write A Review
    Please, wait...