Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ILF2 antibody - C-terminal region (ARP35731_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35731_T100-FITC Conjugated

ARP35731_T100-HRP Conjugated

ARP35731_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Interleukin enhancer binding factor 2, 45kDa
Protein Name:
Interleukin enhancer-binding factor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
NF45, PRO3063
Replacement Item:
This antibody may replace item HPA007484
Description of Target:
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ILF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ILF2.
The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-ILF2 (ARP35731_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ILF2 (ARP35731_T100) antibody is Catalog # AAP35731 (Previous Catalog # AAPP06977)
Printable datasheet for anti-ILF2 (ARP35731_T100) antibody
Sample Type Confirmation:

ILF2 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Shin,H.J., et al., (2002) Arch. Virol. 147 (3), 471-491

Jiang, D., Zhou, Y., Moxley, R. A. & Jarrett, H. W. Purification and identification of positive regulators binding to a novel element in the c-Jun promoter. Biochemistry 47, 9318-34 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18690718

Yamauchi, T. et al. Sepantronium bromide (YM155) induces disruption of the ILF3/p54(nrb) complex, which is required for survivin expression. Biochem. Biophys. Res. Commun. 425, 711-6 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22842455

Tell us what you think about this item!

Write A Review
    Please, wait...