Now Offering Over 102,157 Antibodies & 44,722 Antigens!

IL1B Recombinant Protein (Human) (OPCA04187)

* Required Fields

$0.00
In Stock
Gene Symbol:
IL1B
Official Gene Full Name:
interleukin 1 beta
NCBI Gene Id:
3553
Alias Symbols:
Catabolin, IL-1, IL-1B, IL1-BETA, IL-1 beta, IL1F2, Interleukin-1 beta
Description of Target:
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Swissprot Id:
P01584
Protein Accession #:
NP_000567
Nucleotide Accession #:
NM_000576
Protein Name:
Interleukin-1 beta
Molecular Weight:
33 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL1B.
Product Format:
Liquid 20mM Tris-HCl buffer (pH 8.0) with 50% glycerol
Physical Appearance: Sterile filtered colorless solution
Species Reactivity:
Human
Concentration:
Varies by lot. See vial for exact concentration.
Purity:
Greater than 90% as determined by SDS-PAGE.
Purification:
Affinity purified using IMAC.
Protein Sequence:
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Source:
E.coli
Additional Information:
Protein Description: Full Length
Tag:
N-terminal 6xHis-SUMO-tagged
Reconstitution and Storage:
Store at -20/-80°C for 12 months. Store working aliquots at 4°C for up to one week. Repeated freezing and thawing is not recommended.
Target Reference:
Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647(1985)
Datasheets/Manuals:
Printable datasheet for OPCA04187
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...