Now Offering Over 102,157 Antibodies & 44,722 Antigens!

IKBKB antibody - N-terminal region (ARP32665_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32665_P050-FITC Conjugated

ARP32665_P050-HRP Conjugated

ARP32665_P050-Biotin Conjugated

Gene Symbol:
IKBKB
NCBI Gene Id:
3551
Official Gene Full Name:
Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Protein Name:
Inhibitor of nuclear factor kappa-B kinase subunit beta
Swissprot Id:
O14920
Protein Accession #:
NP_001547
Nucleotide Accession #:
NM_001556
Alias Symbols:
FLJ40509, IKK-beta, IKK2, IKKB, MGC131801, NFKBIKB
Replacement Item:
This antibody may replace item sc-112055 from Santa Cruz Biotechnology.
Description of Target:
NFKB1 or NFKB2 is bound to REL, RELA, or RELB to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-203 AL708460.1 9-211 204-3077 AF080158.1 170-3043 3078-3916 AK023193.1 1980-2818
Protein Size (# AA):
756
Molecular Weight:
86kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IKBKB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IKBKB.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-IKBKB (ARP32665_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BCL10; IKBKG; UBC; Snap23; RELA; NFKBIA; MTOR; RPTOR; ROCK1; IKBKB; CDC37; KEAP1; MAP3K7; FLNC; NGFR; EGLN3; SASH1; COPS5; COPS3; PPP1CA; TPX2; TNFRSF1A; AURKA; PRKCQ; MAP3K1; TFAP2C; NLRC5; PYCARD; TAB2; IKBKE; MAP3K14; CHUK; HSPB1; PRKCE; NAA20; TRAF3IP
Blocking Peptide:
For anti-IKBKB (ARP32665_P050) antibody is Catalog # AAP32665 (Previous Catalog # AAPP03675)
Datasheets/Manuals:
Printable datasheet for anti-IKBKB (ARP32665_P050) antibody
Sample Type Confirmation:

IKBKB is strongly supported by BioGPS gene expression data to be expressed in 721_B

Subunit:
beta
Target Reference:
Hu,W., (2008) Biochem. J. 412 (1), 35-43

Tell us what you think about this item!

Write A Review
    Please, wait...