Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ik Antibody - C-terminal region (ARP51307_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP51307_P050-FITC Conjugated

ARP51307_P050-HRP Conjugated

ARP51307_P050-Biotin Conjugated

Gene Symbol:
Ik
NCBI Gene Id:
24010
Protein Name:
Protein Red
Swissprot Id:
Q9Z1M8
Protein Accession #:
NP_036009
Nucleotide Accession #:
NM_011879
Alias Symbols:
MuRED
Replacement Item:
This antibody may replace item sc-135485 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
557
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ik.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ik
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide Sequence:
Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Eed; Foxp3; Lmna;
Blocking Peptide:
For anti-Ik (ARP51307_P050) antibody is Catalog # AAP51307
Datasheets/Manuals:
Printable datasheet for anti-Ik (ARP51307_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...