website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

IGF1R antibody - middle region (AVARP00004_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

AVARP00004_P050-FITC Conjugated

AVARP00004_P050-HRP Conjugated

AVARP00004_P050-Biotin Conjugated

Gene Symbol:
IGF1R
NCBI Gene Id:
3480
Official Gene Full Name:
Insulin-like growth factor 1 receptor
Protein Name:
Insulin-like growth factor 1 receptor
Swissprot Id:
P08069
Protein Accession #:
NP_000866
Nucleotide Accession #:
NM_000875
Alias Symbols:
CD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR
Replacement Item:
This antibody may replace item sc-113594 from Santa Cruz Biotechnology.
Description of Target:
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c
Protein Size (# AA):
1367
Molecular Weight:
71kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IGF1R.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IGF1R.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-IGF1R (AVARP00004_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KCNIP3; UBC; ESR1; PHB2; SHC1; FBXO6; SH2B1; Slc23a3; RPL11; HSP90AA1; GRB14; FFAR2; ARRB2; AMY2A; APP; RUVBL1; GNB2L1; ARRB1; YWHAG; TP53; NEDD4; MDM2; GRB10; SUMO1; CAMP; ERBB2; EGFR; KRT27; DOK5; DOK4; WISP2; EHD1; ARHGEF12; PIK3R3; VAV3; PRKD1; SOCS2;
Blocking Peptide:
For anti-IGF1R (AVARP00004_P050) antibody is Catalog # AAP30448 (Previous Catalog # AAPP01032)
Datasheets / Downloads:
Printable datasheet for anti-IGF1R (AVARP00004_P050) antibody
Specificity:
Directed to the beta chain of IGF1R
Target Reference:
Urano,T., (2008) Spine 33 (11), 1256-1261
Publications:

Kubota, T. et al. Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading. Acta Astronaut. 92, 73-78 (2013). IHC, Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 23976802

Product Protocols: IGF1R antibody tested with Human Jurkat Cells (AVARP00004_P050)

Aviva Systems Biology is the original manufacturer of this IGF1R antibody (AVARP00004_P050)

Click here to view the IGF1R antibody Western Blot Protocol

Product Datasheet Link: IGF1R antibody (AVARP00004_P050)

WB Suggested Anti-IGF1R Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s IGF1R antibody (AVARP00004_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: IGF1R antibody - middle region (AVARP00004_P050) using Immunofluorescence (IF)

Product Page Link: IGF1R antibody - middle region (AVARP00004_P050)

Data Provided by: Anonymous Researcher

The figure below is an immunofluorescent IGF1R detection in mouse skeletal muscle (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). This antibody is also recommended for IHC on mouse tissue, but not on human tissue. The working dilution for this antibody is 2-10ug/ml.

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...