Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HTR7 antibody - N-terminal region (AVARP13048_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP13048_P050-FITC Conjugated

AVARP13048_P050-HRP Conjugated

AVARP13048_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
HTR7
NCBI Gene Id:
3363
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
Protein Name:
5-hydroxytryptamine receptor 7
Swissprot Id:
P34969
Protein Accession #:
NP_062873
Nucleotide Accession #:
NM_019859
Alias Symbols:
5-HT7
Description of Target:
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by g proteins that stimulate adenylate cyclase.
Protein Size (# AA):
479
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR7
Species Reactivity:
Dog, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rat: 92%
Complete computational species homology data:
Anti-HTR7 (AVARP13048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GPRASP2; GPRASP1; RHOBTB3; CUL3;
Blocking Peptide:
For anti-HTR7 (AVARP13048_P050) antibody is Catalog # AAP30722
Datasheets/Manuals:
Printable datasheet for anti-HTR7 (AVARP13048_P050) antibody
Target Reference:
Ikeda,M., et al., (2006) Neuropsychopharmacology 31 (4), 866-871

Tell us what you think about this item!

Write A Review
    Please, wait...