Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HTR3B antibody - N-terminal region (ARP35186_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35186_P050-FITC Conjugated

ARP35186_P050-HRP Conjugated

ARP35186_P050-Biotin Conjugated

Gene Symbol:
HTR3B
NCBI Gene Id:
9177
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
Protein Name:
5-hydroxytryptamine receptor 3B
Swissprot Id:
O95264
Protein Accession #:
NP_006019
Nucleotide Accession #:
NM_006028
Alias Symbols:
5-HT3B
Replacement Item:
This antibody may replace item sc-51198 from Santa Cruz Biotechnology.
Description of Target:
The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.
Protein Size (# AA):
441
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR3B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3B
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 77%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-HTR3B (ARP35186_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HTR3B (ARP35186_P050) antibody is Catalog # AAP35186 (Previous Catalog # AAPP06421)
Datasheets/Manuals:
Printable datasheet for anti-HTR3B (ARP35186_P050) antibody
Target Reference:
Michel,K., et al., (2005) Gastroenterology. 128(5), 1317-26

Tell us what you think about this item!

Write A Review
    Please, wait...