Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HTR2B antibody - N-terminal region (ARP30716_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP30716_P050-FITC Conjugated

ARP30716_P050-HRP Conjugated

ARP30716_P050-Biotin Conjugated

Gene Symbol:
HTR2B
NCBI Gene Id:
3357
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Protein Name:
5-hydroxytryptamine receptor 2B
Swissprot Id:
P41595
Protein Accession #:
NP_000858
Nucleotide Accession #:
NM_000867
Alias Symbols:
5-HT(2B), 5-HT2B
Replacement Item:
This antibody may replace item sc-15076 from Santa Cruz Biotechnology.
Description of Target:
Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
Protein Size (# AA):
481
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR2B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 80%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Pig: 87%
Complete computational species homology data:
Anti-HTR2B (ARP30716_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AGTR1; SNTA1; LNX1; GNAQ; GNA11;
Blocking Peptide:
For anti-HTR2B (ARP30716_P050) antibody is Catalog # AAP30716 (Previous Catalog # AAPP01373)
Datasheets/Manuals:
Printable datasheet for anti-HTR2B (ARP30716_P050) antibody
Sample Type Confirmation:

HTR2B is supported by BioGPS gene expression data to be expressed in 721_B

Tell us what you think about this item!

Write A Review
    Please, wait...