website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HSPA4L antibody - C-terminal region (ARP53693_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP53693_P050-FITC Conjugated

ARP53693_P050-HRP Conjugated

ARP53693_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heat shock 70kDa protein 4-like
Protein Name:
Heat shock 70 kDa protein 4L
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
APG-1, Osp94, HSPH3
Replacement Item:
This antibody may replace item sc-118470 from Santa Cruz Biotechnology.
Description of Target:
HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA4L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA4L.
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 80%
Complete computational species homology data:
Anti-HSPA4L (ARP53693_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPA4L (ARP53693_P050) antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Datasheets / Downloads:
Printable datasheet for anti-HSPA4L (ARP53693_P050) antibody
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Du, ZN; Rong, CT; Hui, S; Peng, Z; Jin, SH; Li, SJ; Wang, HY; Li, JY; Expression and function of HSP110 family in mouse testis after vasectomy. , (2016). 26952955

Product Protocols: HSPA4L antibody tested with Human Fetal Brain Tissue (ARP53693_P050)

Aviva Systems Biology is the original manufacturer of this HSPA4L antibody (ARP53693_P050)

Click here to view the HSPA4L antibody Western Blot Protocol

Product Datasheet Link: HSPA4L antibody (ARP53693_P050)

WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:

Description of Target: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s HSPA4L antibody (ARP53693_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...