Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HSPA1L antibody - C-terminal region (ARP53636_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP53636_P050-FITC Conjugated

ARP53636_P050-HRP Conjugated

ARP53636_P050-Biotin Conjugated

Gene Symbol:
HSPA1L
NCBI Gene Id:
3305
Official Gene Full Name:
Heat shock 70kDa protein 1-like
Protein Name:
Heat shock 70 kDa protein 1-like
Swissprot Id:
P34931
Protein Accession #:
NP_005518
Nucleotide Accession #:
NM_005527
Alias Symbols:
HSP70-HOM, hum70t, HSP70T, HSP70-1L
Replacement Item:
This antibody may replace item sc-133679 from Santa Cruz Biotechnology.
Description of Target:
HSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
641
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA1L.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
Species Reactivity:
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Complete computational species homology data:
Anti-HSPA1L (ARP53636_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TUBG1; TP53; CDC20; AIRE; NEDD1; CEP250; CEP57; STUB1; BAG4; DNAJC7; STAU1; UBC; ZBTB1; TRIM25; XPO1; RAP1GDS1; NUCB2; HSPA5; GAPDH; CLU; CAMK1D; UBQLN1; IPO7; PARK2; BAG3; HDAC6; K5; METTL21C; DCP1B; METTL21A; CFTR; METTL22; DCP1A; METTL21B; UBL4A; TRAF3
Blocking Peptide:
For anti-HSPA1L (ARP53636_P050) antibody is Catalog # AAP53636 (Previous Catalog # AAPP30476)
Datasheets/Manuals:
Printable datasheet for anti-HSPA1L (ARP53636_P050) antibody
Target Reference:
Buraczynska,M., (er) Clin. Sci. (2008) In press
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...