Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HOXC6 antibody - C-terminal region (ARP38484_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38484_P050-FITC Conjugated

ARP38484_P050-HRP Conjugated

ARP38484_P050-Biotin Conjugated

Gene Symbol:
HOXC6
NCBI Gene Id:
3223
Official Gene Full Name:
Homeobox C6
Protein Name:
Homeobox protein Hox-C6
Swissprot Id:
P09630
Protein Accession #:
NP_710160
Nucleotide Accession #:
NM_153693
Alias Symbols:
CP25, HHO.C8, HOX3, HOX3C
Replacement Item:
This antibody may replace item sc-376330 from Santa Cruz Biotechnology.
Description of Target:
This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Protein Size (# AA):
153
Molecular Weight:
18kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXC6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXC6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXC6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-HOXC6 (ARP38484_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP; HMGB1;
Blocking Peptide:
For anti-HOXC6 (ARP38484_P050) antibody is Catalog # AAP38484 (Previous Catalog # AAPP23193)
Datasheets/Manuals:
Printable datasheet for anti-HOXC6 (ARP38484_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...