Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HLX1 antibody - middle region (P100839_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

P100839_T100-FITC Conjugated

P100839_T100-HRP Conjugated

P100839_T100-Biotin Conjugated

Gene Symbol:
HLX
NCBI Gene Id:
3142
Official Gene Full Name:
H2.0-like homeobox
Protein Name:
H2.0-like homeobox protein
Swissprot Id:
Q14774
Protein Accession #:
NP_068777
Nucleotide Accession #:
NM_021958
Alias Symbols:
HB24, HLX1
Replacement Item:
This antibody may replace item sc-133657 from Santa Cruz Biotechnology.
Description of Target:
H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
Protein Size (# AA):
488
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HLX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HLX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HLX1
Species Reactivity:
Zebrafish
Predicted Homology Based on Immunogen Sequence:
Zebrafish: 92%
Complete computational species homology data:
Anti-HLX1 (P100839_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-HLX (P100839_T100) antibody is Catalog # AAP31195 (Previous Catalog # AAPP01938)
Datasheets/Manuals:
Printable datasheet for anti-HLX (P100839_T100) antibody
Target Reference:
Kennedy, M.A., et al., (1994) Genomics 22 (2), 348-355.

Tell us what you think about this item!

Write A Review
    Please, wait...