Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HK2 antibody - N-terminal region (ARP54303_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP54303_P050-FITC Conjugated

ARP54303_P050-HRP Conjugated

ARP54303_P050-Biotin Conjugated

Gene Symbol:
HK2
NCBI Gene Id:
3099
Official Gene Full Name:
Hexokinase 2
Protein Name:
Hexokinase-2
Swissprot Id:
P52789
Protein Accession #:
NP_000180
Nucleotide Accession #:
NM_000189
Alias Symbols:
DKFZp686M1669, HKII, HXK2
Replacement Item:
This antibody may replace item sc-120925 from Santa Cruz Biotechnology.
Description of Target:
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-348 AI278414.1 4-351 349-732 CB160837.1 11-394 c 733-1006 BM912287.1 1-274 c 1007-1333 AI085541.1 1-327 c 1334-1477 AW134604.1 8-151 1478-4058 AF148513.1 1-2581 4059-5498 BC064369.1 2575-4014 5499-5615 BM706373.1 303-419 5616-7109 BC064369.1 4130-5623
Protein Size (# AA):
917
Molecular Weight:
102kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HK2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-HK2 (ARP54303_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBQLN1; MAGEA12; SUMO2; SUMO3; UBC; EGFR; rev; H2AFV; WDR61; ARIH2; PDLIM1; PYGL; NUBP1; IPO5; HEXB; FNTA; FBXO6; PARK2; UBD; ITGA4; NUDCD3; UBQLN4; SLC2A4; ELAVL1; PTGDS; ZBTB17; PRKCE; IGFBP4;
Blocking Peptide:
For anti-HK2 (ARP54303_P050) antibody is Catalog # AAP54303 (Previous Catalog # AAPP31052)
Datasheets/Manuals:
Printable datasheet for anti-HK2 (ARP54303_P050) antibody
Sample Type Confirmation:

HK2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Additional Information:
IHC Information: 721_B cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 6-18%.
Target Reference:
Paudyal,B., (2008) Cancer Sci. 99 (2), 260-266

Tell us what you think about this item!

Write A Review
    Please, wait...