Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HIF1A antibody - middle region (ARP38054_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38054_P050-FITC Conjugated

ARP38054_P050-HRP Conjugated

ARP38054_P050-Biotin Conjugated

Gene Symbol:
HIF1A
NCBI Gene Id:
3091
Official Gene Full Name:
Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Protein Name:
Hypoxia-inducible factor 1-alpha
Swissprot Id:
Q16665
Protein Accession #:
NP_001521
Nucleotide Accession #:
NM_001530
Alias Symbols:
HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Replacement Item:
This antibody may replace item sc-10790 from Santa Cruz Biotechnology.
Description of Target:
Hypoxia-inducible factor-1 (HIF1) is a transcription factor found in mammalian cells cultured under reduced oxygen tension that plays an essential role in cellular and systemic homeostatic responses to hypoxia. HIF1 is a heterodimer composed of an alpha s
Protein Size (# AA):
826
Molecular Weight:
93kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HIF1A
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
ARP38054_P050
Peptide Sequence:
Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HDAC1; EP300; ARNTL; HDAC3; VHL; UBC; SUMO3; EGLN3; HIF1AN; SENP3; HSP90AA1; ATM; ARNT2; SART3; SUMO2; SIN3A; TRIM28; HSPA4; TRAF6; GNB2L1; EGLN1; SQSTM1; SUMO1; HEXIM1; LAMP2; HSPA8; RB1; SP1; SMAD3; MAFK; PCGF2; TCEB2; TCEB1; MAFG; HSP90AB1; DCUN1D1; RB
Blocking Peptide:
Catalog # AAP38054 (Previous Catalog # AAPP20228)
Datasheets/Manuals:
Printable datasheet for ARP38054_P050
Target Reference:
Kitajima,Y., (2008) Cancer Sci. 99 (7), 1341-1347

Tell us what you think about this item!

Write A Review
    Please, wait...